Cnn3 (NM_028044) Mouse Recombinant Protein

CAT#: TP504859

Purified recombinant protein of Mouse calponin 3, acidic (Cnn3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204859 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGLGIGTNFQLGLKDGIILCELINKLQPGSV
  KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI
  GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT
  NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV
  IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYPDDYPREYQYGDDQGIDY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 36.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082320
• Locus ID: 71994
• UniProt ID: Q9DAW9
• Cytogenetics: 3 G1
• Refseq Size: 2003
• Refseq ORF: 993
• Synonyms: 1600014M03Rik; C85854; Calpo3
• Summary: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function]