OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ptgr1 (NM_025968) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504840
Purified recombinant protein of Mouse prostaglandin reductase 1 (Ptgr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ptgr1 or NM_025968"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204840 protein sequence
Red=Cloning site Green=Tags(s)

MVQAKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMMGEQVAR
VVESKNSAFPKGTIVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVK
GGETVMVSAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDG
YDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVR
QKALTELMNWVSEGKVQYHEHVTEGFEKMPAAFMGMLKGENLGKTIVKA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080244
Locus ID 67103
UniProt ID Q91YR9
Cytogenetics 4 B3
RefSeq Size 2104
RefSeq ORF 987
Synonyms 2510002C21Rik; Ltb4dh; Zadh3
Summary Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4 (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Mapping Novel Metabolic Nodes Targeted by Anti-Cancer Drugs that Impair Triple-Negative Breast Cancer Pathogenicity
Roberts, Yan, Bateman et al
ACS Chem. Biol. (2017)
AI Summary: OriGene’s recombinant PTGR1 protein was used in gel-based activity-based protein profiling assays to investigate how licochalcone A impairs triple-negative breast cancer cell pathogenicity by inhibiting PTGR1 enzyme activity.
Snippet: Gel-based ABPP methods were performed as previously described.43 Recombinant PTGR1 (0.1 μg) protein (Origene) was pretreated with DMSO or licochalcone A, respectively, for 1 h at 37 °C in an incubation volume of 50 μL of PBS and was subsequently treated ... All 3 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products