OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ppp1cb (NM_172707) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504795
Purified recombinant protein of Mouse protein phosphatase 1 catalytic subunit beta (Ppp1cb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ppp1cb or NM_172707"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204795 protein sequence
Red=Cloning site Green=Tags(s)

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD
LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK
RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK
DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG
MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766295
Locus ID 19046
UniProt ID P62141
Cytogenetics 5 B1
RefSeq Size 4024
RefSeq ORF 981
Synonyms 1200010B19
Summary Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products