Rbks (NM_153196) Mouse Recombinant Protein

CAT#: TP504688

Purified recombinant protein of Mouse ribokinase (Rbks), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204688 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAACGEPGRPWQEEEAAAVVVVGSCMTDLVSLTSRLPKTGETIHGHEFFIGFGGKGANQCVQAARLGAKA
  AIVCKVGNDSFGNDYIENLKQNHISTEFTYQTRDAATGTASIIVNNEGQNIIVIVAGANLFLNSEDLKKA
  ASVISRAKVMICQLEISPAASLEALTMARRSGVKTLFNPAPAMADLDPQFYTLSSIFCCNESEAEILTGH
  AVSDPTTAGKAAMILLERGCQVVVITLGASGCVILSQAEPVPKHIPTEAVKAVDTTGAGDSFVGALAFYL
  AYYPNLSLEEMLKRSNFIAAVSVQATGTQSSYPYKKDLPLALF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_694876
• Locus ID: 71336
• UniProt ID: Q8R1Q9
• Cytogenetics: 5 B1
• Refseq Size: 1047
• Refseq ORF: 972
• Synonyms: 5230400M11Rik; AI326806; RBSK; RK
• Summary: Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histidine, and tryptophan, or as a component of the pentose phosphate pathway.[UniProtKB/Swiss-Prot Function]