OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ybx1 (NM_011732) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504659
Purified recombinant protein of Mouse Y box protein 1 (Ybx1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ybx1 or NM_011732"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204659 representing NM_011732
Red=Cloning site Green=Tags(s)

MSSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGY
GFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADR
NHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPP
VQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYR
RNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035862
Locus ID 22608
UniProt ID P62960
Cytogenetics 4 D2.1
RefSeq Size 2191
RefSeq ORF 966
Synonyms 1700102N10Rik; C79409; dbpB; EF1A; MSY1; mYB-1a; Nsep1; YB-1
Summary Mediates pre-mRNA alternative splicing regulation. Component of the CRD-mediated complex that promotes MYC mRNA stability. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. Regulates the transcription of numerous genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). May play a role in DNA repair. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds preferentially to 5'-CUCUGCG-3' motif in vitro (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Satellite RNAs promote pancreatic oncogenic processes via the dysfunction of YBX1
Kishikawa, Otsuka, Yoshikawa et al
Nat Commun (2016) 7, 13006 DOI: 10.1038/ncomms13006
Cited by 64
AI Summary: OriGene products pCMV6-mYBX1-cDNA-GFP (MG204659) and pCMV6kan-mYBX1-cDNA (MC204526) were used to overexpress YBX1 protein and generate YBX1-GFP fusion constructs, enabling the study of YBX1’s role in pancreatic oncogenic processes driven by satellite RNAs.
Snippet: Using this plasmid as a template, PCR-amplified HA-tagged YBX1 ORF was subcloned into the pCDH-CMV-MCS-EF1-Neo vector (pCDH-HA-YBX1). To express YBX1 protein conjugated with GFP protein (pLVSIN-YBX1-GFP), the pCMV6-mYBX1-cDNA-GFP vector (MG204659, OriGene) was purchased and subcloned into the pLVSIN-EF1a neo vector (TaKaRa) at the BamHI site using the InFusion HD cloning kit. For the overexpression of YBX1 protein, the pCMV6kan-mYBX1-cDNA vector (MC204526) was purchased from OriGene Technologies (Rockville, MD, USA)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products