Sgcb (NM_011890) Mouse Recombinant Protein

CAT#: TP504617

Purified recombinant protein of Mouse sarcoglycan, beta (dystrophin-associated glycoprotein) (Sgcb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204617 representing NM_011890
  Red=Cloning site Green=Tags(s)
  
  MAAAAAAAAATEQQGSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICV
  IVLLFILAVINLLITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVIT
  GNNQPIVFQQGTTKLSVEKNKTSITSDIGMQFFDPRTHNILFSTDYETHEFHLPSGVKSLNVQKASTERI
  TSNATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGDVELKAENSIILNGTVMVSPTRLPSSSSGDQSG
  SGDWVRYKLCMCADGTLFKVQVTGHNMGCQVSDNPCGNTH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036020
• Locus ID: 24051
• UniProt ID: P82349
• Cytogenetics: 5 C3.3
• Refseq Size: 3727
• Refseq ORF: 960
• Synonyms: 43kDa; AI747103; AI844814; beta-SG
• Summary: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.[UniProtKB/Swiss-Prot Function]