Ggh (NM_010281) Mouse Recombinant Protein

CAT#: TP504547

Purified recombinant protein of Mouse gamma-glutamyl hydrolase (Ggh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204547 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANLGYLLCLLGLLLCGLSSPGMSRPYNHGSERPIIGVVMQECFGKMAKLGNYYIAASYVKYIESAGARV
  VPIRPDLSDAEYEELFRSINGVLLPGGGANLTDSGYSRVAKIFFSKALESFDNGGHFPVWGTCLGFEELS
  VLVSGENLLTSTDTKSKKLPLNFTEGARKSRMFKHFPTELLDSLALENLTANFHKWSLSVKNFTENEKLK
  KFFNILTTNTDGKTEFISSMEGFKYPVYAVQWHPEKAPFEWKNLGGISHAPNAVKTSFYLAEFLVSEARK
  NSHHFENVVKETASLIYKVYPIYTGNISSFQQAYMFD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034411
• Locus ID: 14590
• UniProt ID: Q9Z0L8
• Cytogenetics: 4 A3
• Refseq Size: 1340
• Refseq ORF: 954
• Synonyms: gamma-GH
• Summary: Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Acts as endopeptidase. Lysosomal enzyme is activated by sulfhydryl compounds.[UniProtKB/Swiss-Prot Function]