OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Coq9 (BC036386) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504460
Purified recombinant protein of Mouse coenzyme Q9 homolog (yeast) (cDNA clone MGC:41458 IMAGE:1067021), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Coq9 or BC036386"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204460 protein sequence
Red=Cloning site Green=Tags(s)

MAATAAVSGVLGRLGWRLLQLRCLPVARCRPALVPRAFHTAVGFRSSEEQKQQPPHSSSQQHSETQGPEF
SRPPPRYTDQSGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGSDGSEL
ILHFVTQCNARLNQVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPHNIPP
SLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGH
TAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 67914
UniProt ID Q8K1Z0
Cytogenetics 8 C5
RefSeq Size 1717
RefSeq ORF 939
Synonyms 2310005O14Rik; C78387
Summary Lipid-binding protein involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PubMed:25339443). Binds a phospholipid of at least 10 carbons in each acyl group. May be required to present its bound-lipid to COQ7 (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products