OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pim2 (BC027376) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504426
Purified recombinant protein of Mouse proviral integration site 2 (cDNA clone MGC:37188 IMAGE:4954711), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA363062 PIM2 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Pim2 or BC027376"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204426 protein sequence
Red=Cloning site Green=Tags(s)

MLTKPLQGHPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLG
WSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGPLGESCS
RSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
RHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEI
LLDPWMQSPAEEKPINSSKGSPTPLPWSLLP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 18715
UniProt ID Q62070
Cytogenetics X 3.55 cM
RefSeq Size 1974
RefSeq ORF 933
Synonyms DXCch3; Pim-2
Summary Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products