OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cope (NM_021538) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504352
Purified recombinant protein of Mouse coatomer protein complex, subunit epsilon (Cope), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Cope or NM_021538"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204352 protein sequence
Red=Cloning site Green=Tags(s)

MAPPVPGAVSGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPEREVERDVFLYRAYLAQRKYGVVL
DEIKPSSAPELQAVRMFAEYLASENQRDSIVLELDREMSRSVDVTNTTFLLMAASIYFHDQNPDAALRTL
HQGDGLECMAMTIQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVNLAVGGEKLQEAYYIFQELAD
KCSPTLLLLNGQAACHSAQGRWETAEGVLQEALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDA
HRAHPFIKEYQAKENDFDRLAMQYAPSA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067513
Locus ID 59042
UniProt ID O89079
Cytogenetics 8 B3.3
RefSeq Size 1043
RefSeq ORF 924
Synonyms 1110005D17Rik; Cope1
Summary The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated with ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products