OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Wdfy1 (BC025226) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504332
Purified recombinant protein of Mouse WD repeat and FYVE domain containing 1 (cDNA clone MGC:32262 IMAGE:5011404), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357373 Wdfy1 Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Wdfy1 or BC025226"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204332 protein sequence
Red=Cloning site Green=Tags(s)

MNFIKTYPAHQNRVSAIIFSLSAEWVISTGHDKCVSWMCTRSGNMLGRHFFSSWASCLQYDLDTQHAFVG
DYSGQITLLKLEQNTCSVITTLKGHEGSIACLWWDPIQRLLFSGASDNSVIMWDIGGRKGRTLLLQGHHD
RVQSLCYLQLTRQLVSCSADGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQMWDTKTLGLRQHH
CRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVT
CGTDRVVKIWDMTPVVGCSLATGFSPH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 69368
UniProt ID E9Q4P1
Cytogenetics 1 C4
RefSeq Size 1363
RefSeq ORF 921
Synonyms 1700120F24Rik, WDF1, FENS-1, Jr1, ZFYVE17
Summary Positively regulates TLR3- and TLR4-mediated signaling pathways by bridging the interaction between TLR3 or TLR4 and TICAM1. Promotes TLR3/4 ligand-induced activation of transcription factors IRF3 and NF-kappa-B, as well as the production of IFN-beta and inflammatory cytokines (PubMed:25736436).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products