Cyb5r1 (NM_028057) Mouse Recombinant Protein

CAT#: TP504299

Purified recombinant protein of Mouse cytochrome b5 reductase 1 (Cyb5r1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGIQPSPVLLASLGVGLLTLLGLALGTYLVRRSRRPQVTLQDPDEKYLLRLLDKTTVSHNTRRFRFALPT
  AHHILGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKI
  GDMVEFRGPSGLLSYAGKGNFNIQPNKKSPPELRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL
  LFANQTERDIILREDLEELQAQYPNRFKLWFTLDSPPEDWTYSKGFVTADMIQEHLPAPAEDVLLLLCGP
  PPMVQLACHPNLDKLGYSQKMRFTY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082333
• Locus ID: 72017
• UniProt ID: Q9DB73
• Cytogenetics: 1 E4
• Refseq Size: 1626
• Refseq ORF: 918
• Synonyms: 1500005G05Rik; B5R.1; C80155; Nqo3a2
• Summary: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.[UniProtKB/Swiss-Prot Function]