Igfbp2 (NM_008342) Mouse Recombinant Protein

CAT#: TP504287

Purified recombinant protein of Mouse insulin-like growth factor binding protein 2 (Igfbp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Igfbp2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204287 representing NM_008342
  Red=Cloning site Green=Tags(s)
  
  MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPPDAPCAELVREPGCGC
  CSVCARQEGEACGVYIPRCAQTLRCYPNPGSELPLKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLV
  ENHVDGTMNMLGGGSSAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQE
  LDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTI
  RGDPECHLFYNEQQETGGAHAQSVQ
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 33.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032368
• Locus ID: 16008
• UniProt ID: P47877
• Cytogenetics: 1 36.94 cM
• Refseq Size: 1342
• Refseq ORF: 915
• Synonyms: AI255832; IBP-2; IGFBP; Igfbp-2; mIGFBP-2
• Summary: The protein encoded by this gene is one of several similar proteins that bind insulin-like growth factors I and II (Igf-I and Igf-II). The encoded protein can be secreted into the bloodstream, where it binds Igf-I and Igf-II with high affinity, or it can remain intracellular, interacting with many different ligands. Two transcript variants, one encoding a secreted isoform and the other encoding a nonsecreted isoform, have been found for this gene. [provided by RefSeq, Sep 2015]