Rpp40 (NM_145938) Mouse Recombinant Protein

CAT#: TP504239

Purified recombinant protein of Mouse ribonuclease P 40 subunit (Rpp40), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204239 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDIGPYYSVKNLPLHELITHEFINTFVKKGSFSALTYNTSIDEDNTVALLPNGKLILSLDKDTYEETGLQ
  GRPSRYSGRKSMKFVISIDLMDLSLNLDSKKYRRISWSFKEKKPLKFDFLLAWHPTGTEESTMMSYFSKY
  QIQEHQPKVALSTVRELQCPVLRSSGLAGEPEEACSALEFFDWLGAVFCSADLNNEPYNFISTYCCPQPS
  AVVAQAFLCTITGFILPEKIHVLLEQLCHYFDEPKLAPWVTLTVQGFADSPVAWREKEHGFHKGGEHLYN
  FVVFNNQDYWLQMAVGANDDCPP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666050
• Locus ID: 208366
• UniProt ID: Q8R1F9
• Cytogenetics: 13 A3.3
• Refseq Size: 2736
• Refseq ORF: 912
• Synonyms: D8Bwg1265e; Rnasep1
• Summary: Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.[UniProtKB/Swiss-Prot Function]