OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Abhd10 (NM_172511) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504120
Purified recombinant protein of Mouse abhydrolase domain containing 10 (Abhd10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Abhd10 or NM_172511"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204120 protein sequence
Red=Cloning site Green=Tags(s)

MAAWAPCRRWGWAAVSFGRHPGLSASLARKPPRAWWLSACRQKASLSFLNRSELPNLAYKRLKGKTPGII
FIPGYLSNMNGIKAVAVEEFCKSLGHAFIRFDYSGIGSSDGNLAECTVGKWRKDVLSILDDVAEGPQILV
GSSLGGWLMLHAAIARPEKVIALIGIATAADGLVTQYHALPVETQKEIEMKGEWTLPSRYNKEGYFRIPY
SFIKEAEHHCLLHSPIPVTCPVRLLHGMKDEIVPWQRSLQVADRIVSPDVDVILRKQGDHRMKEKADIHL
LICTIDDLIDKLSTVVP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766099
Locus ID 213012
UniProt ID Q6PE15
Cytogenetics 16 B5
RefSeq Size 2860
RefSeq ORF 891
Summary This gene encodes a mitochondrially-localized enzyme that acts as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There are two pseudogenes for this gene on chromosome 8. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products