Raly (NM_023130) Mouse Recombinant Protein

CAT#: TP504103

Purified recombinant protein of Mouse hnRNP-associated with lethal yellow (Raly), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204103 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARA
  AVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVR
  RVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDGKKKGD
  SSSGGGGGSSGGGGSSNVGGGSGGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEE
  ELEHSQDTDAEDGALQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075619
• Locus ID: 19383
• UniProt ID: Q64012, Q3U3F6
• Cytogenetics: 2 76.83 cM
• Refseq Size: 1794
• Refseq ORF: 891
• Synonyms: AI663842; Merc
• Summary: RNA-binding protein that acts as a transcriptional cofactor for cholesterol biosynthetic genes in the liver (PubMed:27251289). Binds the lipid-responsive non-coding RNA LeXis and is required for LeXis-mediated effect on cholesterogenesis (PubMed:27251289). May be a heterogeneous nuclear ribonucleoprotein (hnRNP) (By similarity).[UniProtKB/Swiss-Prot Function]