OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Otud6b (NM_152812) Mouse Recombinant Protein

Be the first to review this product
SKU
TP504060
Purified recombinant protein of Mouse OTU domain containing 6B (Otud6b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Otud6b or NM_152812"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR204060 protein sequence
Red=Cloning site Green=Tags(s)

MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQL
KQLTFKDSKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLA
QILAARELEIKQIPSDGHCMYGALEDQLREQDCALTVASLRRQTAEYMQTHSDDFLPFLTNPSTGDMYTP
EEFGKYCDDIVNTAAWGGQLELRALSHILQTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYN
SVTRLVNSATENCS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 33.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_690025
Locus ID 72201
UniProt ID Q8K2H2
Cytogenetics 4 A1
RefSeq Size 3311
RefSeq ORF 882
Synonyms 2600013N14Rik; AU015433
Summary Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 (By similarity). May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation (By similarity). May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation (By similarity). May also play a role in proteasome assembly and function (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products