Ccnd2 (NM_009829) Mouse Recombinant Protein

CAT#: TP503949

Purified recombinant protein of Mouse cyclin D2 (Ccnd2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203949 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQK
  CEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWEL
  VVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAI
  CGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATT
  PTDVRDVDL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033959
• Locus ID: 12444
• UniProt ID: P30280, Q4FK45
• Cytogenetics: 6 61.92 cM
• Refseq Size: 5772
• Refseq ORF: 870
• Synonyms: 2600016F06Rik; AI256817; BF642806; C86853; cD2; Vin-1; Vin1
• Summary: Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).[UniProtKB/Swiss-Prot Function]