Pnp (BC052679) Mouse Recombinant Protein

CAT#: TP503940

Purified recombinant protein of Mouse purine-nucleoside phosphorylase (cDNA clone MGC:60531 IMAGE:30062908), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203940 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENEFTYEDYETTAKWLLQHTEYRPQVAVICGSGLGGLTAHLKEAQIFDYNEIPNFPQSTVQGHAGRLVF
  GLLNGRCCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPG
  FCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFTAWKQMGEQRKLQEGTYVMLAGPNFETVAESRLLK
  MLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYENLEKANHMEVLDAGKAAAQTLERFVSILME
  SIPLPDRGS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 18950
• UniProt ID: P23492
• Cytogenetics: 14 26.31 cM
• Refseq Size: 1305
• Refseq ORF: 867
• Synonyms: AL024301; AU015798; Np; Np-1; Np-2; Pnp1
• Summary: The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.[UniProtKB/Swiss-Prot Function]