Ddah1 (NM_026993) Mouse Recombinant Protein

CAT#: TP503883

Purified recombinant protein of Mouse dimethylarginine dimethylaminohydrolase 1 (Ddah1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203883 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLGHPSAFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHELYVGVLGSKLGLQVVQLPADES
  LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV
  GLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD
  KLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFIN
  KKIDS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 31.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081269
• Locus ID: 69219
• UniProt ID: Q9CWS0, Q3UF01
• Cytogenetics: 3 H2
• Refseq Size: 3747
• Refseq ORF: 858
• Synonyms: 2410006N07Rik; 2510015N06Rik; AI987801; AW050362
• Summary: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.[UniProtKB/Swiss-Prot Function]