OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ermn (NM_029972) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503796
Purified recombinant protein of Mouse ermin, ERM-like protein (Ermn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ermn or NM_029972"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203796 protein sequence
Red=Cloning site Green=Tags(s)

MTDTPETLSGTECNGDRPPENGQQPSSQTRQETTDADETQAYYKVEPSLEDLPAKENQEETGNTKGNILP
KGPEDEKILNENPEENLFVVHQAIKDLSLQEISAEDMAFREGHPWKKIPPNSSNLEVSRQKERTAQQQLE
QRGDASTTEIEWLGFQKSRPVDILHSKCDEEEEEEEEVWNEEINEEDVDECAEEEDEVRVIEFKRKHREG
SPLKEESLAREDSPLGSPGSQPGTPDEQPVFGKKGDIARNSYSRYNTISYRKIRKGNTKQRIDEFESMMH
L

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_084248
Locus ID 77767
UniProt ID Q5EBJ4
Cytogenetics 2
RefSeq Size 3550
RefSeq ORF 843
Synonyms A330104H05Rik; AI854460; ermin; mKIAA1189
Summary Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products