OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Uck1 (NM_011675) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503731
Purified recombinant protein of Mouse uridine-cytidine kinase 1 (Uck1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Uck1 or NM_011675"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203731 protein sequence
Red=Cloning site Green=Tags(s)

MASAGGGGSESAAPEADRPQPRPFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLVILSQDCFYKV
LTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI
LVFYTQEIRDMFHLRLFVDTDSDVRLSRRVLRDVQRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVII
PRGVDNMVAINLIVQHIQDILNGDLCKRHRGGPNGRNHKRTFPEPGDHPGVLATGKRSHLESSSRPH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035805
Locus ID 22245
UniProt ID P52623
Cytogenetics 2 B
RefSeq Size 1966
RefSeq ORF 831
Synonyms Umpk; URK1
Summary Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Expression of nucleoside-metabolizing enzymes in myelodysplastic syndromes and modulation of response to azacitidine
Valencia, Masala, Rossi et al
Leukemia (2013)
Cited by 93
AI Summary: OriGene products contributed to this study by providing the UCK1-targeting siRNAs (SR313172C and SR3131172B) used to silence UCK1 expression and assess its role in azacitidine response in myelodysplastic syndromes.
Snippet: 33. siRNA transfection. For UCK1 silencing, two siRNAs were used: SR313172C (siUCK1-1) (AUAAUGAUUUGAUGCACAGGACUCT) and SR3131172B (siUCK1-2) (GGUUUAAAGAUCCCUCUAGGUCACT) (OriGene Technologies, Inc., Rockville, MD, USA). ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products