OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dnajb2 (NM_001159885) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503725
Purified recombinant protein of Mouse DnaJ heat shock protein family (Hsp40) member B2 (Dnajb2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Dnajb2 or NM_001159885"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203725 protein sequence
Red=Cloning site Green=Tags(s)

MASYYEILDVPRSAFPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR
EGLTGAGSGPSRSETGGAGPGFTFTFRSPEEVFREFFGSGDPFSELFDDLGVFSELQNQGPRLTGPFFTF
SSSFPANSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVSINGVPD
DLALGLELSRREQQPSVAPGLGVMQVRPTSLSRPPDHDLSEDEDLQLAMAYSLSEMEAAGQKPADVF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001153357
Locus ID 56812
UniProt ID Q9QYI5
Cytogenetics 1 C4
RefSeq Size 1918
RefSeq ORF 831
Synonyms 2700059H22Rik; Dnajb10; Hsj1; mDj8
Summary Functions as a co-chaperone, regulating the substrate binding and activating the ATPase activity of chaperones of the HSP70/heat shock protein 70 family. In parallel, also contributes to the ubiquitin-dependent proteasomal degradation of misfolded proteins. Thereby, may regulate the aggregation and promote the functional recovery of misfolded proteins like HTT, MC4R, PRKN, RHO and SOD1 and be crucial for many biological processes. Isoform 1 which is localized to the endoplasmic reticulum membranes may specifically function in ER-associated protein degradation of misfolded proteins.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products