OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Igfbp1 (NM_008341) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503644SE
Purified recombinant protein of Mouse insulin-like growth factor binding protein 1 (Igfbp1), (Secreted), 20ug
Size:
20 ug
  $900.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Igfbp1 or NM_008341"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203644 protein sequence
Red=Cloning site Green=Tags(s)

MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPPVPASCPEISRPAGCGCCPTCALPMG
AACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVPEPAAPATSTLSSSQHEEAKAAVVSADELSESP
EMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIADLKKWKEPCQRELYKVLERLAAAQQKAGDE
IYKFYLPNCNKNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVHN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.4 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Preparation Conditioned medium was collected from overexpressed HEK293 cells. Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032367
Locus ID 16006
UniProt ID P47876
Cytogenetics 11 4.75 cM
RefSeq Size 1522
RefSeq ORF 816
Synonyms IGFBP-1
Summary IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products