Igfbp1 (NM_008341) Mouse Recombinant Protein

CAT#: TP503644

Purified recombinant protein of Mouse insulin-like growth factor binding protein 1 (Igfbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Igfbp1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203644 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPPVPASCPEISRPAGCGCCPTCALPMG
  AACGVATARCAQGLSCRALPGEPRPLHALTRGQGACVPEPAAPATSTLSSSQHEEAKAAVVSADELSESP
  EMTEEQLLDSFHLMAPSREDQPILWNAISTYSSMRAREIADLKKWKEPCQRELYKVLERLAAAQQKAGDE
  IYKFYLPNCNKNGFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVHN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032367
• Locus ID: 16006
• UniProt ID: P47876
• Cytogenetics: 11 4.75 cM
• Refseq Size: 1522
• Refseq ORF: 819
• Synonyms: IGFBP-1
• Summary: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).[UniProtKB/Swiss-Prot Function]