OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Crybb1 (NM_023695) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503610
Purified recombinant protein of Mouse crystallin, beta B1 (Crybb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Crybb1 or NM_023695"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203610 protein sequence
Red=Cloning site Green=Tags(s)

MSQAAKASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPGSYRLIVFEQENFQGR
RVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQSAFRGEMFVLEKGEYPRWDTWTSSYRSDRLMSFRPI
RMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDRVGSITVSGGTWVGYQYPGYRGYQYLLEPGD
FRHWNEWGAFQPQMQAVRRLRDRQWHQEGCFPVLTAEPPQVRQAPGLPSTARPASRPIFPY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076184
Locus ID 12960
UniProt ID Q9WVJ5
Cytogenetics 5 54.63 cM
RefSeq Size 873
RefSeq ORF 813
Synonyms 3110006K12Rik; BB1CRY
Summary This gene encodes a member of the crystallin family of proteins that contribute to the transparency and refractive properties of the ocular lens. The encoded protein associates with other beta crystallin proteins to form dimers, tetramers and other higher-order complexes. This gene is located adjacent to a related crystallin gene on chromosome 5. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2015
Protein Categories Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products