OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ttc19 (BC037111) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503543
Purified recombinant protein of Mouse tetratricopeptide repeat domain 19 (cDNA clone MGC:47198 IMAGE:5370464), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329950 Rabbit Polyclonal Anti-TTC19 Antibody
100 ul
$525.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ttc19 or BC037111"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203543 representing BC037111
Red=Cloning site Green=Tags(s)

MKDEPEAAELILHDALRLAYESDNRKAITYTYDLMANLAFIRGQLENAEQLFKATMSYLLGGGMKQEDNA
IIEISLKLANIYAAQNKQEFALAGYEFCISTLEGKIEREKELAEDIMSEETANTYLLLGMCLDSCARYLL
FSKQLSQAQRMYEKALQICQEIQGERHPQTIVLMSDLATTLDAQGHFDDAYIYMQRASDLAREINHPELH
MVLSNLAAILIHRERYTQAKEIYQEALKRAELKRDEVSVQHIREELAELSRKSRRLT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 93.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 72795
UniProt ID Q8CC21
Cytogenetics 11 B2
RefSeq Size 2548
RefSeq ORF 801
Synonyms 2010204O13Rik; 2810460C24Rik; AI505442
Summary Required for the preservation of the structural and functional integrity of mitochondrial respiratory complex III by allowing the physiological turnover of the Rieske protein UQCRFS1 (PubMed:21278747, PubMed:28673544). Involved in the clearance of UQCRFS1 N-terminal fragments, which are produced upon incorporation into the complex III and whose presence is detrimental for its catalytic activity (PubMed:28673544).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products