Usb1 (NM_133954) Mouse Recombinant Protein

CAT#: TP503537

Purified recombinant protein of Mouse U6 snRNA biogenesis 1 (Usb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203537 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSAPLVGYSSSGSEDEAEAVAAGRSKPGTGFHRCGQNPVPSEKLPVPDSVLSMFPSTEEGPEDDSAKHG
  GRIRTFPHERGNWATHIYIPYEAKEDFRDLLDALLPRAQMFVPRLVLMEEFHVSLSQSVVLRHHWILPFV
  QVLKDRMASFQRFFFTANRVKIYTNQEKTRTFIGLEVSSGHAQFLDLVSEVDRAMKEFDLTTFYQDPSFH
  ISLAWCVGDASLQLEGQCLQELQEIVDEFEDSEMLLRVLANQVRCKSGNKFFSMPLK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598715
• Locus ID: 101985
• UniProt ID: Q91W78, A0A0R4J0E0
• Cytogenetics: 8 C5
• Refseq Size: 1764
• Refseq ORF: 804
• Synonyms: AA960436
• Summary: Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA 3' end-terminated with a 2',3'-cyclic phosphate.[UniProtKB/Swiss-Prot Function]