OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Emc10 (NM_197991) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503345
Purified recombinant protein of Mouse ER membrane protein complex subunit 10 (Emc10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Emc10 or NM_197991"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203345 protein sequence
Red=Cloning site Green=Tags(s)

MVAAGAGVTRLLVLLLMVAAAPSRARGSGCRVGASARGTGADGREAEGCGTVALLLEHSFELGDGANFQK
RGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVES
HLSDQLTLHVDVAGNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIERLEMEQA
QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDAGGQGGGGGGGSSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_932108
Locus ID 69683
UniProt ID Q3TAS6
Cytogenetics 7 B3
RefSeq Size 1855
RefSeq ORF 774
Synonyms 2310044H10Rik; 5430410O10Rik; Inm02; Mirta22
Summary Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products