OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nt5c3l (BC015307) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503318
Purified recombinant protein of Mouse 5'-nucleotidase, cytosolic III-like (cDNA clone MGC:19356 IMAGE:4239117), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Nt5c3l or BC015307"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203318 protein sequence
Red=Cloning site Green=Tags(s)

MTLSRFAYNGQRCPSSHNILDNSKIISEDCRKELTELFHHYYPIEIDPHRTIKEKLPHMVQWWSKAHSLL
CQQRIQKVQIAQVVGESTAMLREGYKTFFDTLYQNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNY
MDFSEDGFLKGFKGQLIHTYNKNSSVCENSSYFQQLQNKTNIILLGDSIGDLTMADGVPGVQNILKIGFL
NDKVEERRERYMDSYDIVLEKDETLDVVNGLLRHILYQGDCVELQGS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 68106
UniProt ID Q3UFY7
Cytogenetics 11 D
RefSeq Size 1390
RefSeq ORF 771
Synonyms 2610037D24Rik; AI841843; C330027I04Rik; Nt5c3l
Summary Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate. The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids. Also has weak activity for CMP. UMP and purine nucleotides are poor substrates (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products