Prdx3 (NM_007452) Mouse Recombinant Protein

CAT#: TP503317

Purified recombinant protein of Mouse peroxiredoxin 3 (Prdx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAGRLLWSSVARHASAISRSISASTVLRPVASRRTCLTDILWSASAQGKSAFSTSSSFHTPAVTQHA
  PYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFS
  HLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESAGIALRGLFIIDPNGVVKHLSVNDLPVGRSV
  EETLRLVKAFQFVETHGEVCPANWTPESPTIKPSPTASKEYFEKVHQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 28.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031478
• Locus ID: 11757
• UniProt ID: P20108
• Cytogenetics: 19 56.52 cM
• Refseq Size: 1445
• Refseq ORF: 774
• Synonyms: Aop1; AW822249; D0Tohi1; Ef2l; Mer5; Prx3; SP22; TDXM
• Summary: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides.[UniProtKB/Swiss-Prot Function]