OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fstl3 (NM_031380) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503294
Purified recombinant protein of Mouse follistatin-like 3 (Fstl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Fstl3 or NM_031380"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203294 protein sequence
Red=Cloning site Green=Tags(s)

MRSGALWPLLWGALVWTVGSVGAVMGSEDSVPGGVCWLQQGREATCSLVLKTRVSREECCASGNINTAWS
NFTHPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECVPNCEGLPAGFQVCGSDGATY
RDECELRTARCRGHPDLRVMYRGRCQKSCAQVVCPRPQSCLVDQTGSAHCVVCRAAPCPVPSNPGQELCG
NNNVTYISSCHLRQATCFLGRSIGVRHPGICTGGPKVPAEEEENFV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_113557
Locus ID 83554
UniProt ID Q9EQC7
Cytogenetics 10 C1
RefSeq Size 1953
RefSeq ORF 768
Synonyms E030038F23Rik; Flrg
Summary The secreted form is a binding and antagonizing protein for members of the TGF-beta family, such us activin, BMP2 and MSTN. Inhibits activin A-, activin B-, BMP2- and MSDT-induced cellular signaling; more effective on activin A than on activin B. Involved in bone formation; inhibits osteoclast differentiation. Involved in hematopoiesis; involved in differentiation of hemopoietic progenitor cells, increases hematopoietic cell adhesion to fibronectin and seems to contribute to the adhesion of hematopoietic precursor cells to the bone marrow stroma. The nuclear form is probably involved in transcriptional regulation via interaction with MLLT10 (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products