Kcnip4 (BC051130) Mouse Recombinant Protein

SKU TP503186

Purified recombinant protein of Mouse Kv channel interacting protein 4 (cDNA clone MGC:58176 IMAGE:6532082), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203186 protein sequence; Red=Cloning site Green=Tags(s); ; MNVRRVESISAQLEEASSTGGFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRP; EALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAV; SFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVE; TFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 28.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• Locus ID: 80334
• UniProt ID: Q6PHZ8
• Cytogenetics: 5 B3
• RefSeq Size: 2392
• RefSeq ORF: 750
• Synonyms: KChIP4, Calp250, Calp
• Summary: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels, such as KCND2/Kv4.2 and KCND3/Kv4.3 (PubMed:19109250). Modulates channel expression at the cell membrane, gating characteristics, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner.[UniProtKB/Swiss-Prot Function]