OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ifi30 (NM_023065) Mouse Recombinant Protein

Be the first to review this product
SKU
TP503154
Purified recombinant protein of Mouse interferon gamma inducible protein 30 (Ifi30), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ifi30 or NM_023065"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR203154 protein sequence
Red=Cloning site Green=Tags(s)

MSWSPILPFLSLLLLLFPLEVPRAATASLSQASSEGTTTCKVHDVCLLGPRPLPPSPPVRVSLYYESLCG
ACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAF
LTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEK
PLKDPSELLSIVCQLYQGTEKPDICSSIADSPRKVCYK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_075552
Locus ID 65972
UniProt ID Q9ESY9
Cytogenetics 8 B3.3
RefSeq Size 997
RefSeq ORF 744
Synonyms GILT; IP30
Summary Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products