Ifi30 (NM_023065) Mouse Recombinant Protein

SKU TP503154

Purified recombinant protein of Mouse interferon gamma inducible protein 30 (Ifi30), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203154 protein sequence; Red=Cloning site Green=Tags(s); ; MSWSPILPFLSLLLLLFPLEVPRAATASLSQASSEGTTTCKVHDVCLLGPRPLPPSPPVRVSLYYESLCG; ACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAF; LTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEK; PLKDPSELLSIVCQLYQGTEKPDICSSIADSPRKVCYK; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 27.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_075552
• Locus ID: 65972
• UniProt ID: Q9ESY9
• Cytogenetics: 8 B3.3
• RefSeq Size: 997
• RefSeq ORF: 744
• Synonyms: GILT; IP30
• Summary: Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.[UniProtKB/Swiss-Prot Function]