Bdh2 (NM_027208) Mouse Recombinant Protein

CAT#: TP503075

Purified recombinant protein of Mouse 3-hydroxybutyrate dehydrogenase, type 2 (Bdh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203075 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVTKKRQIDQFAS
  EIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVASSIKG
  VENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGR
  FASAEEVALLCVYLASDESAYVTGNPVIIDGGWSL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081484
• Locus ID: 69772
• UniProt ID: Q8JZV9
• Cytogenetics: 3 G3
• Refseq Size: 1099
• Refseq ORF: 738
• Synonyms: 1810026B04Rik; Dhrs6
• Summary: Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron assimilation and homeostasis (PubMed:20550936, PubMed:24863067). Plays a role in susceptibility to bacterial infection by providing an assimilable source of iron that is exploited by pathogenic bacteria (PubMed:24863067). Also acts as a 3-hydroxybutyrate dehydrogenase (By similarity).[UniProtKB/Swiss-Prot Function]