Eif6 (NM_010579) Mouse Recombinant Protein

CAT#: TP503068

Purified recombinant protein of Mouse eukaryotic translation initiation factor 6 (Eif6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203068 representing NM_010579
  Red=Cloning site Green=Tags(s)
  
  MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIGRMCVGNRHGL
  LVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ
  TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT
  TSTELSVVESVFKLNEAKPSTIATSMRDSLIDSLT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 27 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034709
• Locus ID: 16418
• UniProt ID: O55135, Q545K4
• Cytogenetics: 2 H1
• Refseq Size: 1495
• Refseq ORF: 735
• Synonyms: 1110004P11; AA408895; CAB; eIF; eIF-6; imc-41; imc-415; Itgb4; Itgb4bp; p27(BBP); p27B; p27BBP
• Summary: The protein encoded by this gene is a eukaryotic translation initiation factor that regulates both ribosome biogenesis and translation, which are rate-limiting factors for cell growth. The encoded protein binds 60S ribosomes and prevents their association with 40S ribosomes. This gene may play a role in oncogenesis as well. [provided by RefSeq, Aug 2015]