Neurog1 (NM_010896) Mouse Recombinant Protein

CAT#: TP503033

Purified recombinant protein of Mouse neurogenin 1 (Neurog1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203033 representing NM_010896
  Red=Cloning site Green=Tags(s)
  
  MPAPLETCISDLDCSSSNSSSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPALSGASNVPGAQDEEQ
  ERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYN
  YIWALAETLRLADQGLPGGSARERLLPPQCVPCLPGPPSPASDTESWGSGAAASPCATVASPLSDPSSPS
  ASEDFTYGPGDPLFSFPGLPKDLLHTTPCFIPYH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035026
• Locus ID: 18014
• UniProt ID: P70660
• Cytogenetics: 13 30.06 cM
• Refseq Size: 1707
• Refseq ORF: 732
• Synonyms: AKA; bHLHa6; Math4C; Neurod3; ngn1
• Summary: Acts as a transcriptional regulator. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis.[UniProtKB/Swiss-Prot Function]