OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Clic1 (NM_033444) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502985
Purified recombinant protein of Mouse chloride intracellular channel 1 (Clic1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA363146 CLIC1 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Clic1 or NM_033444"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202985 protein sequence
Red=Cloning site Green=Tags(s)

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG
TEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL
DNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL
SNAYAREEFASTCPDDEEIELAYEQVARALK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_254279
Locus ID 114584
UniProt ID Q9Z1Q5
Cytogenetics 17 18.58 cM
RefSeq Size 1159
RefSeq ORF 723
Synonyms Clcp; G6
Summary Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Wicking: a rapid method for manually inserting ion channels into planar lipid bilayers
Costa, Nguyen, Leal-Pinto et al
PLoS ONE (2013) 8 (5), e60836 DOI: 10.1371/journal.pone.0060836
Cited by 11
AI Summary: In this study, the researchers used human recombinant CLIC1 protein with a Myc-DDK tag from OriGene (Cat# TP303433) to prepare proteoliposomes for testing their new rapid "wicking" method of ion channel insertion into planar lipid bilayers.
Snippet: Preparation of CLIC1 wicking proteoliposomes. The CLIC1 protein used in these experiments, purchased from OriGene (Rockville, MD), is a human recombinant protein containing a Myc-DDK tag and was expressed/purified from 293-HEK cells.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products