OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Psme2 (NM_011190) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502937
Purified recombinant protein of Mouse proteasome (prosome, macropain) activator subunit 2 (PA28 beta) (Psme2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Psme2 or NM_011190"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202937 protein sequence
Red=Cloning site Green=Tags(s)

MAKPCGVRLSGEARKQVDVFRQNLFQEADDFLCTFLPRKIISLSQLLQEDSLNVADLSSLRAPLDIPIPD
PPPKDDEMETDKQEKKEVPKCGYLPGNEKLLALLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGV
AIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKDTHVMDYRALVHERDEAAYGALRAMVLDLR
AFYAELYHIISSNLEKIVNPKGEEKPSMY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035320
Locus ID 19188
UniProt ID P97372
Cytogenetics 14 28.19 cM
RefSeq Size 906
RefSeq ORF 717
Synonyms AA589371; AI788882; PA28b
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Carfilzomib alleviated osteoporosis by targeting PSME1/2 to activate Wnt/β-catenin signaling
Zhang, Attarilar, Xie et al
Mol Cell Endocrinol (2021) 540, 111520 DOI: 10.1016/j.mce.2021.111520
Cited by 16
AI Summary: OriGene's PSME1 mouse recombinant protein (TP503169) and PSME2 mouse recombinant protein (TP502937) were used to investigate their effects on osteogenesis and osteoclast formation in vitro, helping to elucidate the molecular mechanisms by which Carfilzomib alleviates osteoporosis.
Snippet: …However, the effect and mechanism of CFZ on OP has Save;cultured with or without PSME1 mouse recombinant protein (OriGene Technologies, Rockville, MD, USA, TP503169), or PSME2 mouse recombinant protein (OriGene Technologies, USA, TP502937),
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products