Vstm2a (NM_145967) Mouse Recombinant Protein

CAT#: TP502852

Purified recombinant protein of Mouse V-set and transmembrane domain containing 2A (Vstm2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202852 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGIFLASVGFMFFSVLYVQQGLSSQAKFTELPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPED
  LEQGTEAAGSQVELLPDRDPDNDGTKISTVKVQGNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHK
  AQAYLKVNANSHARRMQAFEASPMWLQDTKPRKNASSVVPSSVHNSANQRMHSTSSPQAVAKIPKQSPQS
  GARIATSHGLSVLLLVCGFVKGALL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666079
• Locus ID: 211739
• UniProt ID: Q8R0A6
• Cytogenetics: 11 A2
• Refseq Size: 3629
• Refseq ORF: 708
• Synonyms: Vstm2
• Summary: Plays a role in the regulation of the early stage of white and brown preadipocyte cell differentiation. Promotes adipogenic commitment of preadipocytes by increasing gene expression of the transcription factor PPARG in a BMP4-dependent signaling pathway.[UniProtKB/Swiss-Prot Function]