OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

D2Ertd750e (BC031709) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502833
Purified recombinant protein of Mouse DNA segment, Chr 2, ERATO Doi 750, expressed (cDNA clone MGC:30961 IMAGE:4021550), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "D2Ertd750e or BC031709"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202833 protein sequence
Red=Cloning site Green=Tags(s)

MASAKTVCDAQPHSMPSCGLPADTQTRATSKLPVKSKEADLLRHLHPGGPEPDVTKVTKSRRENGQVKAA
ETASRRNLRNSYKPFNKQKPEEELKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLALL
ESKGLNPGQETLASKQEPTTDHTDSMLLLETLKDELKVFNETAKKQMEELQALKVKLKLKEEESVQFLEQ
QTLCKDEASDFTIILEEMEQLLEM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 51944
UniProt ID Q9D9Z1
Cytogenetics 2 E5
RefSeq Size 1218
RefSeq ORF 702
Synonyms 1700025D04Rik; C15orf23; D2Ertd750e; SKAP; Traf4af1
Summary Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products