Lypla2 (NM_011942) Mouse Recombinant Protein

CAT#: TP502786

Purified recombinant protein of Mouse lysophospholipase 2 (Lypla2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202786 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
  VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA
  GIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARVQFKTYPGVMH
  SSCPQEMAAVKEFLEKLLPPV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036072
• Locus ID: 26394
• UniProt ID: Q9WTL7
• Cytogenetics: 4 D3
• Refseq Size: 1593
• Refseq ORF: 696
• Synonyms: LysoII
• Summary: Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins, GAP43, ZDHHC6 or HRAS. Deacylates GAP43. Mediates depalmitoylation of ZDHHC6 (By similarity). Has lysophospholipase activity (PubMed:10064901).[UniProtKB/Swiss-Prot Function]