Cltb (BC070404) Mouse Recombinant Protein

CAT#: TP502747

Purified recombinant protein of Mouse clathrin, light polypeptide (Lcb) (cDNA clone MGC:92950 IMAGE:5699653), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202747 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLASGAGSEDMST
  TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASKVTEQEWREKAKKDLEEWN
  QRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK
  DVSRLRSVLMSLKQTPLSR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 25.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 74325
• UniProt ID: Q6IRU5
• Cytogenetics: 13 B1
• Refseq Size: 1009
• Refseq ORF: 687
• Synonyms: 2310046E19Rik
• Summary: Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.[UniProtKB/Swiss-Prot Function]