OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cd79b (NM_008339) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502725
Purified recombinant protein of Mouse CD79B antigen (Cd79b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA386387 Recombinant Anti-CD79b (Clone HM79-16)
200 ug
$870.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Cd79b or NM_008339"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202725 protein sequence
Red=Cloning site Green=Tags(s)

MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHS
GALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELL
VLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIV
TLRTGEVKWSVGEHPGQE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032365
Locus ID 15985
UniProt ID P15530
Cytogenetics 11 68.89 cM
RefSeq Size 1232
RefSeq ORF 684
Synonyms B29; Ig; Ig-be; Ig-beta; Igb; Igbe; Igbeta
Summary The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Sep 2015
Protein Categories ADC Targets, Cancer: Haematopoietic and Lymphoid, CD Markers, Immune system diseases, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Anti-CD79 Antibody Induces B Cell Anergy That Protects against Autoimmunity
Hardy, Anceriz, Rousseau et al
J. Immunol. (2014)
Cited by 44
AI Summary: OriGene products, specifically the mouse CD79a cDNA in the pCMV6-AC-GFP vector and mouse CD79b cDNA in the pCMV6 vector, were used for cloning and expression studies to investigate the role of CD79 in B cell function in this study.
Snippet: CD79a and CD79b cloning and expression in PEAK cells The cDNAs encoding mouse CD79a (BC027633) in pCMV6-AC-GFP vector and mouse CD79b (NM_008339) in pCMV6 vector were purchased from OriGene Technologies. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products