Hsd17b2 (BC012682) Mouse Recombinant Protein

CAT#: TP502707

Purified recombinant protein of Mouse hydroxysteroid (17-beta) dehydrogenase 2 (Hsd17b2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Hsd17b2 protein (Cat# TP502707). The protein was produced from HEK293T cells transfected with Hsd17b2 cDNA clone (Cat# MR202707) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSPFASESAWLCLAAAAVLGGTLLCGCRSGRQLRSQAVCLAGLWGGACLLSLSLLCTLFLLSVACFLLLY
  MSSSDQDLLPVDQKAVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDV
  TKPEQIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRK
  SKGRLVNVSSMGGTVPL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: AAH12682
• Locus ID: 15486
• UniProt ID: P51658
• Cytogenetics: 8 E1
• Refseq Size: 1280
• Refseq ORF: 1146
• Synonyms: AI194836; AI194967; AI255511
• Summary: Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH (By similarity).[UniProtKB/Swiss-Prot Function]