OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Creg1 (NM_011804) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502502
Purified recombinant protein of Mouse cellular repressor of E1A-stimulated genes 1 (Creg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355981 Creg1 Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Creg1 or NM_011804"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202502 protein sequence
Red=Cloning site Green=Tags(s)

MAARAPELARSLLAALLAPALVALLVSPASGRGGRDHGDWDVDRRLPPLPPREDGPRVARFVTHVSDWGS
LATISTIKEVRGWPFADIISISDGPPGEGTGEPYMYLSPLQQAVSDLQENPEATLTMSLAQTVYCRNHGF
DPQSPLCVHIMMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVLDYFGGPKVVT
PEEYFNVTLQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035934
Locus ID 433375
UniProt ID O88668
Cytogenetics 1 H2.3
RefSeq Size 2138
RefSeq ORF 660
Synonyms AA755314; Creg
Summary May contribute to the transcriptional control of cell growth and differentiation. Antagonizes transcriptional activation and cellular transformation by the adenovirus E1A protein. The transcriptional control activity of cell growth requires interaction with IGF2R (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Recombinant Cellular Repressor of E1A-Stimulated Genes Protects against Renal Fibrosis in Dahl Salt-Sensitive Rats
Liu, Song, Tian et al
Am. J. Nephrol. (2020) 51 (5), 401-410 DOI: 10.1159/000506411
Cited by 10
AI Summary: In this study, the recombinant CREG1 protein (reCREG) from OriGene was used to treat Dahl salt-sensitive rats, demonstrating that it improved renal function and reduced renal fibrosis in a model of high-salt diet-induced hypertensive nephropathy.
Snippet: drugs: (1) HS group: HS diet for 4 weeks without any treatment;(2) HS + saline group: HS rats infused with saline via a subcutaneous osmotic pump;(3) HS + reCREG group: HS rats infused with recombinant CREG1 protein (reCREG;35 µg/kg·day, Origene);(4) HS;- drugs: (1) HS group: HS diet for 4 weeks without any treatment
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products