Gimap4 (BC005577) Mouse Recombinant Protein

CAT#: TP502489

Purified recombinant protein of Mouse GTPase, IMAP family member 4 (cDNA clone MGC:11734 IMAGE:3968418), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202489 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCE
  KRVSTWDGKELVVVDTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDM
  FGKQARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQ
  SMFLSSRMK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 107526
• UniProt ID: Q99JY3
• Cytogenetics: 6 B2.3
• Refseq Size: 1364
• Refseq ORF: 657
• Synonyms: MGC11734, IMAP4, mIAN1
• Summary: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. This gene exists within a cluster of other related genes located on mouse chromosome 6. This family member encodes a lymphoid signaling protein that functions to accelerate programmed T-cell death, which appears to correlate with the phosphorylation status of the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]