Mrps34 (NM_023260) Mouse Recombinant Protein

CAT#: TP502465

Purified recombinant protein of Mouse mitochondrial ribosomal protein S34 (Mrps34), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202465 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARKKVRPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLAR
  LPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEDTAREIEQVMYHDWR
  LVPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPWDYPAKQETK
  GRAKGTPV
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 25.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075749
• Locus ID: 79044
• UniProt ID: Q9JIK9
• Cytogenetics: 17 A3.3
• Refseq Size: 899
• Refseq ORF: 657
• Synonyms: 0610007F04Rik; 5330430D13Rik; AV001970; Tce2
• Summary: Required for mitochondrial translation, plays a role in maintaining the stability of the small ribosomal subunit and the 12S rRNA that are required for mitoribosome formation.[UniProtKB/Swiss-Prot Function]