Mis12 (NM_025993) Mouse Recombinant Protein

SKU TP502174

Purified recombinant protein of Mouse MIS12 kinetochore complex component (Mis12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202174 representing NM_025993; Red=Cloning site Green=Tags(s); ; MSVDPMAYEAQFFGFTPQTCLLRIYVAFQDHLFEVMQAVEQVILKKLEDIPNCEITPVQTRKCTEKFLCF; MKGRFDNLFGKMEQLILQSILCIPPNILLPEDKCQETNPFSEEKLELLQQEIKELQEKYKVELCTEQALL; AELEEQKTVKAKLRETLTFFDELENIGRYQGTSNFRESLASLVQSCRKLQSIRDNVEKESRRLETQ; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_080269
• Locus ID: 67139
• UniProt ID: Q9CY25
• Cytogenetics: 11 B4
• RefSeq Size: 2766
• RefSeq ORF: 618
• Synonyms: 2510025F08Rik; AU044651; Misc12
• Summary: Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis. Essential for proper kinetochore microtubule attachments.[UniProtKB/Swiss-Prot Function]