Myl3 (NM_010859) Mouse Recombinant Protein

CAT#: TP502120

Purified recombinant protein of Mouse myosin, light polypeptide 3 (Myl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Myl3 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202120 representing NM_010859
  Red=Cloning site Green=Tags(s)
  
  MAPKKPEPKKDDAKAAAPKAAPAPAAAPAAAPAAAPEPERPKEAEFDASKIKIEFTPEQIEEFKEAFLLF
  DRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFETFLPMLQHISKNKDTGTYE
  DFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMAS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034989
• Locus ID: 17897
• UniProt ID: P09542
• Cytogenetics: 9 60.69 cM
• Refseq Size: 898
• Refseq ORF: 612
• Synonyms: MLC1s; MLC1v; Mylc; VLC1
• Summary: Regulatory light chain of myosin. Does not bind calcium.[UniProtKB/Swiss-Prot Function]